DPCstruct | MC1410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 122 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498NY62 | 72-179 | SRMPNIFLKVETARMCELLHYFCDCELRHRIEAIVSFSDSFVSKLQFNQKFRYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLN… |
| A0A067QFG8 | 8-123 | LADGKDEHKKGLLQMKMAEGAKLQMCYLLHHLCDIQLRHRVESTIAFSHDFISDLQTDQLRRNVEIKQSDMPSAVAAKKTREFRCPP… |
| A0A183SPW1 | 845-957 | None |
| A0A437BYE0 | 2-99 | None |
| A0A0N4WID4 | 90-215 | None |
| A0A6J0XIR1 | 296-440 | None |
| A0A1S3T525 | 371-480 | None |
| A0A0B1STG3 | 87-207 | None |
| A0A183NXT8 | 280-463 | None |
| A0A4Z2JAJ6 | 2-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.