DPCstruct | MC141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 196 ± 21 aa |
| Standard deviation of domain lengths | 21.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1E5N0 | 18-191 | QGQEFSRNKVVKKITVLRDTILLAPTSIYPYDFKVFSLDNKLIDPKEYHVDFVKGKLILNKKRYGKIKVEYLEYPDFVTRRYTSFDK… |
| A0A4Q3U835 | 8-203 | LKAQLNANQRLRKITTTSEIISLDSLSIVPQSIKVSYNENVQADTSLYQIDYAKATFLWKGAAGIELSLSYKVFPILFSKRYFHKDV… |
| A0A257LUE6 | 1-205 | None |
| A0A2M7NMI1 | 2-248 | None |
| A0A388Q339 | 10-202 | None |
| A0A3C0ZQ23 | 23-232 | None |
| A0A4Q6BE50 | 22-194 | None |
| A0A351PXJ0 | 1-166 | None |
| A0A090WAM1 | 1-186 | None |
| A0A6M8V865 | 6-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.