DPCstruct | MC14099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 285 ± 69 aa |
| Standard deviation of domain lengths | 69.44 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538KA87 | 5-209 | EFEDFLYGACLRDWDAEAERMAKIKERFDRASEVRIVGAGTDLTVSLEGREGEVDAGHANLPGGEVYYSPVEDATEGVVHFSEFPAF… |
| A0A1F4XM24 | 45-303 | SIIKALRAADVSVLWVEKGGGEQVTFRSPLLRVIGDNARLRHAHMPGVDVKTIIEAFDQDQGAMQQLTDKVYQIMTHVSRVKVTNPA… |
| A0A7Y5KFX6 | 2-198 | None |
| A0A419IQE5 | 22-343 | None |
| A0A536I5Q9 | 409-748 | None |
| G6EP65 | 8-288 | None |
| A0A7W1M2P3 | 486-857 | None |
| A0A3A4ZPK8 | 47-429 | None |
| A0A1V5USP8 | 351-644 | None |
| A0A0A2TJ83 | 28-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.