DPCstruct | MC14098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 310 ± 30 aa |
| Standard deviation of domain lengths | 29.75 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2AJZ2 | 2-306 | IQKYKQKFLIGFIALLVMSIYIFITTWQSSTYKEVHNMYPLEKSANKEASEEFLKAMEYRIYIKQLHPFFDYDSFIMSPLLEKLDYH… |
| A0A2D3VZW4 | 1-348 | MENEQILIKRKKVKKYLFIFFVGFILLNSFIYWVEYRRYVLLAPSSLQEARKEFTKAIIPHMYYTFLVKTVRIDFQNQLLAPLKKIR… |
| A0A1W1CWG1 | 3-250 | None |
| M5IRW1 | 1-335 | None |
| S3XCX2 | 3-297 | None |
| I2K9U0 | 1-301 | None |
| A0A5B9TW70 | 65-412 | None |
| A0A2G6NM02 | 70-385 | None |
| A0A1G5HVB2 | 65-344 | None |
| A0A525D1N5 | 141-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.