DPCstruct | MC14096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0H297 | 448-529 | AQPPWDKSVGDFFILHFTYGNDYDEHGTFTPGKIGAWRFDKRTWMSGIPPKNLPMPPSGCDNELVKRLVEMVNEASAALPNW |
| A0A7J8QRU2 | 26-92 | CYPPWDTEIGNKFIIHYTYGCDYDLKGRLTYGKIGEWRFDKRSFDTEAPPRNLPLPPPGVPESVVSL |
| A0A835H190 | 1-82 | None |
| A0A7S2D1D1 | 39-110 | None |
| A0A7S0RMB9 | 70-152 | None |
| A0A453EQE8 | 1-69 | None |
| A0A7S3F284 | 45-114 | None |
| A0A6A0AK25 | 3-76 | None |
| A0A2Z6P1S4 | 189-254 | None |
| A0A803L3V2 | 117-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.