DPCstruct | MC14090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 643 ± 91 aa |
| Standard deviation of domain lengths | 91.42 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.88 |
| Pfam Score | 90.76 |
| Assigned Pfam label(s) | PF02671- PF08295- PF16879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0T3M5 | 12-487 | SWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADK… |
| A0A196SPA5 | 53-711 | QTIGSEDFSYSHMRRNQYEEALFRCEDDHFEADVILETTRSAIAQLELLQKELEALEEDGAYKLREDALSAVQTAAIRRVYAHNGMD… |
| A0A7S2WDF1 | 2-646 | None |
| A0A5K4F1Y2 | 25-791 | None |
| A0A842ZFF9 | 2-498 | None |
| A0A6I9Q1V0 | 68-674 | None |
| Q6FNH7 | 275-866 | None |
| A0A0K0EKT0 | 1035-1658 | None |
| A0A6J3CBY4 | 16-690 | None |
| A0A6S8VHN3 | 97-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.