DPCstruct | MC1409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0540 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438EFS1 | 3-89 | FSNGIALICRWVYEGVIDDPYGEFFIAENKSLQKESLTQDYDAKYWGQRYSLKDGIPSFLANAAGTILTTGKYLNVMRECGHNVQVF |
| A0A0A2JYC7 | 388-480 | ASRPYMAMLNEWLHHGGIRDPHAEFLVKEQKWIKREKLEEDYTDEYWEKRYTIREHEVPPQLKSVQDKVLLAGKYLNVVRECGGVDV… |
| A0A7D8YUS8 | 653-743 | None |
| A0A2P6QZ14 | 66-153 | None |
| A0A835M9J2 | 234-335 | None |
| A0A5M9JVQ0 | 388-473 | None |
| A0A098VVW7 | 199-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.