DPCstruct | MC14089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 61.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8C8K2 | 61-132 | FDPVEDVAAPFIGKGARPRVAILREQGVNSHLETAYAFDRAGFDAHDVHMSDLLSGRATLADFAGAVACGGF |
| A0A3P8KGV9 | 40-105 | APYIATGARPKVAVLREQGVNSHVEMAAAFHRAGFDAVDVHMSDLLAGRTGLADFQALVACGGFSY |
| A0A5E6NQW4 | 67-148 | None |
| A0A1E5W079 | 447-529 | None |
| A0A5J5AYX8 | 608-682 | None |
| A0A376TUS7 | 67-132 | None |
| A0A377LV97 | 155-238 | None |
| A0A340X8E8 | 296-361 | None |
| A0A455UI51 | 49-132 | None |
| A0A3M5WQ69 | 166-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.