DPCstruct | MC14083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9UK57 | 583-660 | EHWPSFITNQSCRFESRFILVEVLKSPSILLKDMQGSCIPISIAHSTGRAKFKNIKDLNMIEKLNLITLKYIDNYGTT |
| A0A340X8E8 | 401-495 | NGCQMMSNLSELIPGSEFWPHFVRNRSEQFEARVAMVQVQESNSIFLQGMAGSRMPIAIAHGEGHAEFSSEEALLEADLSGTVALRF… |
| A0A218UA03 | 446-546 | None |
| A0A376SHT7 | 1-79 | None |
| A0A5S6QT58 | 453-538 | None |
| A0A6T6X0A2 | 600-697 | None |
| A0A7S3FF57 | 27-130 | None |
| A0A813GT48 | 540-642 | None |
| A0A196S5V5 | 916-1013 | None |
| W2TDM3 | 336-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.