DPCstruct | MC14078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 342 ± 56 aa |
| Standard deviation of domain lengths | 55.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A196SJG1 | 9-389 | EYGLVFLPKYTVTQVHWENGAINGRVVIGDFHTKVLKCVCTVKDNIIESLEDLSKVEWRIIDLSDDGSRWEGDTLNEVPFGWGVYYD… |
| A0A196S5T8 | 287-600 | CVVLNDSDDDSFFYEGIVAKPCSELVMLSKDGVTIANTETHELLRVDDEDVNGIEHAQVLDLSDDGERWEGDVKDGKPFGWGVLYDS… |
| A0A196SF68 | 34-405 | None |
| A0A196SFK2 | 152-494 | None |
| A0A196SHE9 | 9-230 | None |
| D8LVQ8 | 7-335 | None |
| D8LZJ3 | 16-340 | None |
| D8M5V3 | 6-304 | None |
| D8M5Z3 | 3-308 | None |
| A0A196SEM7 | 3-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.