DPCstruct | MC14077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 233 ± 41 aa |
| Standard deviation of domain lengths | 40.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7FBS2 | 18-289 | WANHYMVNTVDSLAVYNLFAQVDSTLTIDEVTGIIRASSNKADHTLESAVTALGKLFVTGFTPRTGSEYDANRDNLYTDIDKITDEL… |
| A0A099KGD3 | 303-513 | DSLAVMNLLYTLDNSFTLAKANKLLPLASSDEFTELEGVMNYLARLFGQGEVAVTNSDHDEVYSTIKKITDSLGDKTYQISEITSAI… |
| A0A136KBT6 | 236-471 | None |
| A0A0X8JQZ5 | 4-253 | None |
| A0A7W4Z8Y6 | 206-470 | None |
| A0A378QI00 | 294-567 | None |
| A0A7V5R8C5 | 205-421 | None |
| A0A6C2CJ44 | 408-689 | None |
| A7I388 | 68-285 | None |
| A0A2N0DV72 | 264-497 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.