DPCstruct | MC14076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5TS01 | 275-407 | VKTFDLRVTRGLARSPRYRLLGACNGCGRCCESPSIPVSRFTWHFPTARRLFLWWQRVVNGFELKSADARFRVFVFHCTHFDATTRQ… |
| A0A1G6XBJ6 | 4-124 | LARLWLWLWWRCAGRRVVLTGGCRQCGQCCQQIQIQQGRSWLRSRRQFRTLVRRQPEYDRFVISGRDGSGCLLFCCRCLQPNGRCGD… |
| A0A7C7MS38 | 1-110 | None |
| A0A523MU74 | 38-145 | None |
| A0A1F6PW86 | 4-110 | None |
| A0A1F6PW72 | 10-111 | None |
| F8L8N6 | 40-194 | None |
| A0A1F9ND85 | 42-157 | None |
| A0A7J5WH54 | 11-126 | None |
| A0A3A5FXG7 | 65-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.