DPCstruct | MC14075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B0SSR2 | 1-56 | MLAGIHAIAAQAPFRQMQTPGGYTMSVAMTNCGTAGWITDRKGYRYSTTDPLNGQA |
| W9V4E9 | 35-99 | GELLEGIANIEALSPFRRQQTPGGFWMSVSMSNCGSFGWISDRKGYRYAAVDPVTGNLWPAMPAL |
| A0A3N4ARM8 | 54-117 | None |
| A0A2A2K5P6 | 35-88 | None |
| A0A537B8P9 | 326-385 | None |
| A0A447QE19 | 15-67 | None |
| A0A1W4V2E9 | 46-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.