DPCstruct | MC14074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844RT74 | 9-151 | KDVATVIAAAIAIVSATIALGSAFIAFRTFRMSRANQIEALIQKAYYDYAKMALDNPELAFPPGSTEFDYKTQTLHGKPVDFEKYEW… |
| A0A8B0SJ55 | 7-145 | QHFSHISTIATALVAVLALVIAVWQIKAAENIQREASAREAFKEYLKLAIDKPDFANAQPSDNKSAKSGYEWFVTYFLYSAEQIYTA… |
| U1KQ92 | 2-152 | None |
| A0A2N1A648 | 1-184 | None |
| A0A1E3VPF6 | 2-140 | None |
| A0A7V8GWQ9 | 8-188 | None |
| A0A1I5JPA1 | 42-179 | None |
| A0A1X7A485 | 6-146 | None |
| A0A7W5N9Z3 | 2-151 | None |
| A0A3M8TMP4 | 5-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.