DPCstruct | MC14072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 220 ± 33 aa |
| Standard deviation of domain lengths | 33.37 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077L0F9 | 218-454 | EYAYIKIKSGDFTYLNCVGEIRSNDKGLSEFSPHWMDDLPNDKVRQCWDYYSITNRYASIIRNSYPKNWDMGFLEAEFPEAAIFQGI… |
| A0A4R2MDG3 | 1-201 | MRDYDTRWMPGFYLEQFEQGRRDSWRIASNIDRSCQCIWAPGDLSWDYNEEARGPLDAPPSWPVYRLNPQVRVKTDDKIQVSGVYLP… |
| A0A4R6DWG6 | 80-318 | None |
| A0A2V4UQF7 | 81-310 | None |
| W5IUD9 | 95-251 | None |
| A0A0M4LDX1 | 1-239 | None |
| A0A6J5JUZ8 | 5-176 | None |
| A4WCZ5 | 518-782 | None |
| A0A0A0EWQ1 | 81-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.