DPCstruct | MC14071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 351 ± 99 aa |
| Standard deviation of domain lengths | 98.81 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | PF04687- PF00482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0L080 | 41-394 | LQKIDDFLIDHSTVKATEKAQFFGLLSTMLGSGISINKSLKLLRTKTTHPRLRRIIATLSYELEHGRTLSQSMERFADVFTESERGS… |
| A0A4R2M7Z3 | 51-385 | LAATPRQRSEVAWWCGELRSLVYSGMTVVEAMETMAVAADAGSRRELVQSSLLQELRAGHPLSSAMSRVSGYPPVLVASVAAAEQSG… |
| A0A645BVU0 | 2-232 | None |
| A0A7C5QNI9 | 6-385 | None |
| A0A3L7PCE8 | 197-541 | None |
| A0A4V1XRR4 | 41-573 | None |
| W0BIL3 | 2-222 | None |
| G7EIX9 | 2-219 | None |
| A0A812YN14 | 381-697 | None |
| A0A3S4IJJ2 | 1-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.