DPCstruct | MC1407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9VUK9 | 101-177 | GDHYGLDFPISLDMVREFGPEFLTNAFRSAGTILPDNAVTQIVSIQPLDVPGASENAILTVSYAKAEPGIENDLFIK |
| A0A7S2FSA5 | 131-216 | KNEPGDYYGIKFPHSLAQLQDKEFGAAWLTKAFHKSGVLSKSNAVTKILEGKEFVGGGAGLKAIIKVEYKKDKPYLHKDLFIKLPH |
| A0A7S4PU80 | 75-156 | None |
| A0A132T5N3 | 6-73 | None |
| A0A7S4RGI6 | 221-309 | None |
| A0A812XFU2 | 1-102 | None |
| A0A812I246 | 295-395 | None |
| A0A813BHJ9 | 11-87 | None |
| A0A1I2SY81 | 1-95 | None |
| A0A1Q9EWG0 | 638-730 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.