DPCstruct | MC14066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 59 ± 1 aa |
| Standard deviation of domain lengths | 1.45 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 51.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0JFJ4 | 1-58 | MELFRTQQYYILLNKDSTLWIDRTTGQLDAKPAWELANGQDIECLGVFYGLVGRVKYN |
| A0A3B3ISG0 | 1-59 | MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHS |
| A0A0S7IIY5 | 1-59 | None |
| R7VGV9 | 1-62 | None |
| A0A2R2MNU8 | 1-58 | None |
| A0A5K4F132 | 1-61 | None |
| A0A7J7JXK9 | 1-58 | None |
| A0A6J8CU05 | 3-59 | None |
| A0A672L3Y2 | 1-59 | None |
| A0A7M7NVM8 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.