DPCstruct | MC14063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 132 ± 19 aa |
| Standard deviation of domain lengths | 18.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9SI50 | 1-139 | MSTHAYIFEKTEKNYRGIYLHCDGYIESAGRILTEHYTDPDIVSELIDLGSLSVLGFCIGKKTDFDKYDRNGTQCLAYHRDRDEDLE… |
| A0A2E0BIY3 | 1-126 | MSTNARIGIQLNGGIVSVYHHWDGYPQWLGVTLSKKYTTKEDVSELIDGGNMSCIASDTDWDRNKCAEHVQYYTGRGESIEENAPKL… |
| A0A5L4MGC7 | 1-115 | None |
| A0A5L4MHH8 | 1-130 | None |
| A0A7Y9C4S3 | 1-169 | None |
| A0A8A3LG46 | 1-168 | None |
| A0A7W7GU29 | 1-145 | None |
| A0A191ZW08 | 1-121 | None |
| A0A7W6GWG0 | 1-115 | None |
| A0A1Y4HBY5 | 1-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.