DPCstruct | MC14061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9S8F7 | 1-98 | MFEWNTWRAMTILDGGNIVENIKSDDNGNPFSTASGNMADIVCDYGKFALAVEVTMQSGQKQYEMEGEPVSRHLAKLKNETGKEAYC… |
| R9LKP6 | 25-126 | ETPAYLEWTLWRAALAIDHMVNKPYEVRGFKLDSDFMPVSAAGGGKGDLYCEFNDFTILTEVTMSTSSRQEAMEGEPVRRHVSDAVL… |
| A0A376CMN8 | 182-291 | None |
| A0A5A4TU54 | 206-306 | None |
| E6NMA4 | 2-96 | None |
| A0A649Z413 | 293-401 | None |
| A0A1W9QM73 | 1-121 | None |
| A0A6L7ZKF5 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.