DPCstruct | MC14056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | CL0031- CL0408- CL0221- CL0305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2BZF3 | 23-152 | KSQTLIPRPQTFTSELKMVMVVRHDLKMGTGKIAAQCCHACLGLYKSLLKKDLPRIQAWEKGYYKKIVLKCPSEEEMLKIAETASKK… |
| A0A5C7JFI4 | 67-184 | LEYRMYGLVPYNLSPIQQGIQFGHAVVDYGRTAEGLPPHYEIYKKWADKDKTFIILNGGTTNNNPERLGSLNQHMNTLRENGVLLQE… |
| A0A7N0RCC4 | 1-104 | None |
| A0A2P6NI59 | 35-161 | None |
| A0A4S4ET80 | 9-137 | None |
| A0A3D1J684 | 60-197 | None |
| A0A5Q2W062 | 21-235 | None |
| R7QL92 | 71-204 | None |
| A0A6A5DJZ1 | 2-117 | None |
| A0A4R2QXK6 | 35-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.