DPCstruct | MC14053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 219 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2B0L6 | 21-227 | QKKQETLTQSIPKALKKFTAVDKFFKPIKSKKPQYQIKTSSPKKEYIRCKLIRGTKKSIRILNKSSFPNKLGNFESISSQTLINWNA… |
| A0A1R2BNH1 | 1-238 | MSGHYKQLDKRVFIFKNDLRKRKTETLIMKKFFTVKDYNSNPKKEYVRCKVIRGHKKMIRNIIDNKFPTKGIIKINSKDKKQLQIYR… |
| A0A1R2B2D8 | 146-375 | None |
| A0A1R2CG80 | 1-213 | None |
| A0A1R2BE09 | 1-197 | None |
| A0A1R2BDG7 | 33-259 | None |
| A0A1R2AZ27 | 153-352 | None |
| A0A1R2AT56 | 35-222 | None |
| A0A1R2C9R4 | 19-226 | None |
| A0A1R2C801 | 29-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.