DPCstruct | MC14052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF14933- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q22E17 | 6-91 | TPNNPIIPLRLGIKHDPPTLALVYKRKQQDIKERIYSIVLNGLVELSDPKIIALKLFEEHALILNENVIDIDQVEKLVAELQKRYE |
| A0A1R2BL02 | 4-89 | DFIPRRFGLKFEPPTIILEYKIQSKNKLYLHIMPMPELEPSHDPYDWLDILRKEHKPFLDAKVIEEGQILSLIEKLQDNLIGESVE |
| A0A2C9KCI6 | 1-85 | None |
| A0A6V4E9V2 | 4-78 | None |
| A0A0V0QBL6 | 1-93 | None |
| A0A7S4S306 | 438-536 | None |
| K3WPY0 | 2-91 | None |
| A0A4W6FTU2 | 2-79 | None |
| A0A3R7AEZ9 | 4-104 | None |
| A2DMN8 | 3-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.