DPCstruct | MC14051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 219 ± 31 aa |
| Standard deviation of domain lengths | 31.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817BY90 | 1-157 | MDRNANAYSELFYHCVQVLNEYDNNISEETFLEHYFQENEVPNETFVSTILFDCIRHSTLLKTITNIFYATDGIHIRRSEHNIFKII… |
| A0A1R2BJD6 | 3-218 | WADLVPKSIELLTSYNPITDSPDTHFQNNYKSTDDPNEKMFMQQIFYGVNRYRDFLKRLNRAIFKVNATSTNSNDSFPFMIIAYIVS… |
| A0A814VY97 | 8-222 | None |
| A0A814D3N5 | 8-247 | None |
| X6NRS3 | 28-208 | None |
| A0A504XDE4 | 7-241 | None |
| A0A5C6NX96 | 29-275 | None |
| A0A3P9J2P1 | 2-214 | None |
| A0A2R6X372 | 103-390 | None |
| C1ECX0 | 56-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.