DPCstruct | MC14050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 494 ± 87 aa |
| Standard deviation of domain lengths | 87.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6QTK9 | 234-696 | DDMKSFLIKNLSDWAIRMSTLTEVDLRTQFTKKDLFVGFNDETLQNLIIDIIKNNPGVDKNKILEKCKECLIATASSDGIVRAERSA… |
| A0A1R2BIV0 | 121-605 | ETIIAVKLQNWIKSLYVIDTIEIWRPEKLFPINNDDALKLLVSNHCNEDTTEENIEEIIEKCKIELIKIAPADILVIIENASITIDE… |
| A0A2N0QS22 | 699-1090 | None |
| A0A498NXL0 | 447-894 | None |
| K1Q6V8 | 41-604 | None |
| X6M588 | 2-448 | None |
| X6MIB8 | 7-410 | None |
| X6PE60 | 36-607 | None |
| A0A7J7KKF7 | 324-771 | None |
| A0A7J7KTR9 | 473-958 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.