DPCstruct | MC1405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 148 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18860 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5XSS2 | 2-132 | ATPQHRISQVTRRKIADSIALSPFPWCGNLDEPDFSARIYDLRSMRSTDPRYTNAYDDIHQHQVRNYDWGDGWIFTDPRFNLLHVGD… |
| A0A7I7KGJ5 | 1-151 | MATKRITQVTLRRIFDTINLSKVLLEGRLEEPDFLARIHDLDSMSSTASRYKSAAGDIWQHRVNNPQDWPDDSVGTDSRFGLQHGDD… |
| A0A240U4V8 | 98-236 | None |
| A0A5M3WFW4 | 147-305 | None |
| A0A4R1CWG0 | 13-159 | None |
| A0A1F4BER1 | 1-161 | None |
| A0A7X6CMJ8 | 101-256 | None |
| B4EUP8 | 6-143 | None |
| A0A0D0PLW1 | 70-218 | None |
| J0S508 | 2-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.