DPCstruct | MC14049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 184 ± 30 aa |
| Standard deviation of domain lengths | 30.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CRN5 | 1-132 | MSVYSGFSTRALESEYNQCLLQLITILAKRCAQALSVQQLQDDTKFAGNFGKLYGQIKKLEEYKYAPPKYSVALKELSEQIGIIQFK… |
| A0A1R2BHG5 | 1-162 | MSIYSGFGTRQQETAYNALVENTIKILQGKVVSNLKEESINENLFKMQLLKNYEMLIKLEAHKYLLPRFSDSIKDLIKVIVKDQIMS… |
| A0A1R2CLD0 | 1-148 | None |
| A0A078AFW3 | 1-184 | None |
| A0A078A5E4 | 1-171 | None |
| J9ENK5 | 1-230 | None |
| A0A1R2AVK0 | 1-211 | None |
| Q240W0 | 2-190 | None |
| Q22SV0 | 1-187 | None |
| A0EDU5 | 1-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.