DPCstruct | MC14048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 169 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0ZVY6 | 36-208 | AVVSGTNGPDVPQVLASLLQQIQGGDAVVEADTVMKFAKCVNEDTSLKFSAAAQTALDKIIMKRRKMLRLGLRGLASAVLEFVEDAN… |
| A0A1R2BG63 | 23-183 | TKNLYSTQGMSPSQMAVSGFVAGAALDSTSEDLMPCFFDLEKLLLDFKVIVTHINSFNAFSIIKALRSIKDVLKVVPKAIVDCSASH… |
| A0A6A5CCM6 | 1-158 | None |
| A0A812WG31 | 189-369 | None |
| A0A1R2CN48 | 20-170 | None |
| A0A812M9I7 | 675-843 | None |
| F4PN09 | 304-477 | None |
| A0A7S0A3I4 | 8-184 | None |
| A0A7S1KRU6 | 53-206 | None |
| A0A1Q9DR40 | 20-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.