DPCstruct | MC14047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 120 ± 4 aa |
| Standard deviation of domain lengths | 3.99 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 42.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04947 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6WS29 | 123-243 | INKDVIRSVLRSLNMQLYIEKWLQIIQRVTGIEPPKPGNQLLMMLDHSFTELQQPFTHFKAQGRKNFLNYNYVFCRLFQKLGCAQFC… |
| A0A381XB16 | 1-124 | MSRLNHVKMRQILKRLNLNKYYEHIHHIINKLNGLPPPVLSRELEERMRLMFKEIQKPFSECCPKNRKNFLSYSYVIRKFLELLGED… |
| A0A2D7SMI7 | 258-377 | None |
| A0A6C0LD77 | 305-424 | None |
| D8LPD2 | 198-319 | None |
| A0A6C0IA81 | 234-356 | None |
| A0A6C0F140 | 377-496 | None |
| A0A1Y1IUQ3 | 374-493 | None |
| A0A1Y1ING1 | 220-344 | None |
| A0A4Q3L2L1 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.