DPCstruct | MC14046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 144 ± 27 aa |
| Standard deviation of domain lengths | 26.90 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381X5T7 | 125-261 | LSEHRENFFRKICDFVSKSSGSIIIIDYGYSEFLKKFTLQSVFNHQSSNLLDNLGKQDITSLVDFNTLVDIAKNYNFNVDTFCNQKE… |
| A0A258XHT4 | 8-106 | AHTDPLHYVGLQDITAHVDFTSIAHAGVKAGLEFAGFTSQAQFLMNCGMLNLMSQVPAEDMANYVPLAAAAQKLLSPAEMGDLFKVI… |
| A0A7S2Q308 | 655-836 | None |
| A0A7V4MYS1 | 3-116 | None |
| A0A1B8AKV0 | 57-217 | None |
| A0A1M7SKL5 | 465-600 | None |
| A0A2A2KXV9 | 270-407 | None |
| M7YDT1 | 318-473 | None |
| A0A2M7U1M6 | 226-405 | None |
| A0A4Q2XD09 | 4-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.