DPCstruct | MC14044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6HMW6 | 2-92 | LTITEMKARNAAAGYYWFSRGNMRLFKTKIETRPTKDGYFITSDQPGNTDRRFSIQLFDLSTSDVYTIGAFQEFATLADAKAALKTL… |
| A0A1F8PFJ6 | 19-116 | NLDTISLETVKAANHRAGRYWFTPDTTRFFRSRYQEYAYKVGDRAYFITSEQFDDRSPRLFTLRLCDLTTGEVDTVGEFQQYRSRHL… |
| A0A849PU21 | 44-138 | None |
| A0A2G9DBM8 | 2-102 | None |
| A0A0F9EKV1 | 10-103 | None |
| A0A0F9RH30 | 2-91 | None |
| A0A7Y5CXX8 | 6-90 | None |
| A0A842ZKK7 | 67-159 | None |
| A0A419GV82 | 136-222 | None |
| A0A7T4WFB1 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.