DPCstruct | MC14043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 218 ± 36 aa |
| Standard deviation of domain lengths | 36.14 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9JGQ3 | 1-193 | MPLLFIEADNCHEDAATIAAKFDKYMRFYQRTVKYTDGRERPMWHTRWSAPQVQRNVSPAMPPVLLVFHQIGARPARTQMQKVARLT… |
| H0BQC2 | 4-213 | PSVLLVFNHIGARNPNRAMPRLEELTHHLWRGDRQREGHHLYDRKVPIVAVGLRNLREHGPTGPVCYRFGRNRPQPLLETIGNPRRD… |
| A0A1C5F424 | 47-245 | None |
| A0A2N0J7Y9 | 1-191 | None |
| A0A6H1L916 | 2-249 | None |
| A0A6B2YGN2 | 81-295 | None |
| A0A2G7DFL9 | 1-227 | None |
| A0A2U3H2C9 | 73-323 | None |
| A0A6N7L1B9 | 10-209 | None |
| A0A0L8QHX6 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.