DPCstruct | MC14042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 151 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 37.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8WJE0 | 394-528 | QRLDRLLGEYGAEVRRHGLMAAGRFSRDHAPRDALMARMWSESPEALLALRTEATGDMTQLCRSGQLGYLSTSAGAGLVRFGPARLR… |
| H0BM34 | 5-163 | WGAVERGQAGALALVRTEQRVRELLSAARHHLWHYGVLAPPPYPADHRARTTAAGLLGTDSLRVAELVGREADRGAVVQLSSPEQGA… |
| A0A229RK99 | 158-305 | None |
| A0A160P4R3 | 1-135 | None |
| A0A7K3H9I7 | 35-189 | None |
| A0A7K2R3Z5 | 63-220 | None |
| A0A1D8G8C9 | 907-1053 | None |
| A0A7K2KNN6 | 372-541 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.