DPCstruct | MC1404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17252 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L4YTT4 | 30-121 | PLDDEAKRMVLEDLHDLDEFQSLLEPRGVRGICMECAGCEEMHYYEWEIMRSNLLNMLAHHQAHVHEPPFNPKPEEFVSWDYANGYA… |
| A0A7I7KEF8 | 2-89 | AVEADLADLAVYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLIDGTVRPHEPAYDPEPDAYVTWDYCRGYADASLNEATS |
| A0A1J0TQ77 | 2-100 | None |
| A0A537YA33 | 8-110 | None |
| A0A7H0SMA7 | 11-104 | None |
| A0A7V9IZW9 | 12-106 | None |
| A0A1H4M322 | 115-206 | None |
| A0A838K138 | 11-113 | None |
| A0A2G6X9R5 | 61-161 | None |
| A0A538AXX5 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.