DPCstruct | MC14037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 226 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 65.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.86 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4M364 | 1-223 | MDLETENRIASILLREAAELRRQAEKDGVRAYLEKPNVRHRPNSRFLTATVLGVQQSNKAVETNEMWRARQKEIELEDERLKRETRE… |
| A0A2V0P3S3 | 19-260 | TGPEAQRRIAALLIAQAQQLEERAATDGATAFCGRPVQRERLNERFLANTLRGVASTNRRAQERQMWAAWEKEAPAAAAGAARQGAG… |
| A0A6J5VSX5 | 56-332 | None |
| G7IFC3 | 1-224 | None |
| A0A2K2C5C3 | 1-214 | None |
| A0A835R629 | 1-208 | None |
| Q7XIH0 | 11-248 | None |
| A0A061RCR5 | 19-212 | None |
| C1E1K4 | 10-187 | None |
| A0A444Y4K6 | 108-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.