DPCstruct | MC14036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.48 |
| Pfam Score | 84.68 |
| Assigned Pfam label(s) | PF00710- CL0465- PF17763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485BB23 | 2-106 | VIIYGYQDDPEYMYDAAIAHHVDGIVYAGTGAGSVSVRSAAGIEKAQKAGIVVVRASRTGSGVVPADDSQPGLVADSLNPAKARILL… |
| A0A2V0NXE0 | 310-434 | FKLDTNVIRIPIVPGSDPRAMYGDLVGRGVRGVVLEAFGVGNLPDTASHGWLPWLRDQTNKGLKVCLTSQCARGELNPQLYRAGSVA… |
| U6L5J4 | 329-475 | None |
| A0A812IVN5 | 132-275 | None |
| A0A1R0H910 | 120-243 | None |
| A0A1Y1V1P7 | 297-427 | None |
| A0A4U0Y0D1 | 95-238 | None |
| A0A4U0VJC4 | 233-376 | None |
| A0A7U2YIL8 | 6-118 | None |
| A0A7Y0JP31 | 160-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.