DPCstruct | MC14035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 153 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF06246- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2P7I3 | 22-157 | KWVLATCKEYLLLYNVTHKDGTKGKGTGFQKRFLKNEKPIPLKLKLSSQDLVNFKILDVDFTPARFSVGDSEEQMISTSTGPYLIVW… |
| V5E766 | 620-766 | LGDPIIGIDVSSDGRYIIATCKTYLLLIDTLIGQGRYEGQLGFDRPFPADSKPQPKRLTLLPSHVAYMGAPISFSAARFNTGTDSET… |
| A0A0L6V5E0 | 906-1077 | None |
| A0A5J4TKE4 | 5-148 | None |
| S9TW39 | 307-475 | None |
| M8ALQ5 | 263-441 | None |
| A0A2U1QJ05 | 247-424 | None |
| A0A4P1RP49 | 1075-1206 | None |
| A0A653GXV5 | 810-947 | None |
| A0A438FMB1 | 361-531 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.