DPCstruct | MC14032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8LNF5 | 55-187 | KKKDEVQPTPASGGGVVVPVTAEGAQPTDSERVEAECLRSLGLAVGTRLEVMWLLEDDDKSVEKWWGCSVAGAKTGERDEEEGRPVF… |
| A0A2V0NSN2 | 1-131 | MAGYGAYGAYGAYGHPAVQQLPQRPQALPIEALGLTIGSRIEVRWDIVPDEDEGDPYTKWWGARIMRMAAPPPGTMGPCYIIAYDPE… |
| A0A7S0G764 | 3-131 | None |
| A0A7S0LD35 | 1-108 | None |
| A0A2J8AF47 | 1-131 | None |
| K8EKE8 | 75-203 | None |
| A0A835Y8X6 | 6-137 | None |
| A0A2R5GI78 | 128-261 | None |
| A0A7S3JNL6 | 120-243 | None |
| A0A7S0VCK0 | 6-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.