DPCstruct | MC1403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 138 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 18.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0373 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A547NJ24 | 1-164 | MNALYRELAPISDGAWAQIEDEASRTLKRHLAARRVVDVVGPKGFGLSSVGTGHTKPIAAPGEGVQSTQREVKALVELRVPFEPTRQ… |
| A0A7I7KCF0 | 7-141 | SGNSTLLASQVSSLLIQPLEQASTFLAAGPQIIDSASPVRIPRIVSGTSAAFVAAGAQITDSNATFDEVQLLPSTLKGIKTLTKVSN… |
| A0A3B9KKY0 | 267-437 | None |
| A0A2R4JY38 | 11-113 | None |
| A0A7Z6WA58 | 162-274 | None |
| A0A560FKK8 | 546-675 | None |
| A0A842RNU1 | 3-157 | None |
| A0A6G2GGG2 | 2-121 | None |
| A0A223I0W6 | 76-249 | None |
| A0A4R4A8U2 | 134-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.