DPCstruct | MC14029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H4A3J3 | 1-76 | MNDQYAMVFFFRSDCAYCHAFAPTLKQFTQANSLPTYAFTLDGKSMDQFPVPIPATPEVSQLFFDNPRSITVPATF |
| A0A5C4PW20 | 68-139 | DWQIVHFMSSTCSYCRQFNPVLKNITDTIKMPVFTYSFDGIGDDDFPNAIPVNKAILDAFFAELPQATPTDF |
| A0A8B0SU12 | 1-70 | None |
| Q65AG5 | 91-162 | None |
| A0A0N9NB48 | 67-125 | None |
| A0A378VZ91 | 58-123 | None |
| A0A2X1N073 | 1-57 | None |
| A0A077ZHT2 | 70-141 | None |
| A0A7D6DIQ7 | 66-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.