DPCstruct | MC14027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640JXL0 | 7-89 | DPFAQDMFKWSADFEVPSIGADVIIRIYGIGRAKVVGYASQGGYLGVMTVPYSPPDWWIRQNGPPSADNAALAFGAEISLVDT |
| A0A2W5LAM3 | 12-101 | DVPAHTTDMERSDLPKWSGKDPVPAIGQSIYVRINRIGAAKVVGYAIDCGYLGVLAYPLDPPPWWVKQNGPSSPENAPLVFGAELQV… |
| A0A4Z0EKY4 | 38-111 | None |
| A0A3D1UZ65 | 111-187 | None |
| A0A2D6XE63 | 7-84 | None |
| A0A4Z0PZB4 | 23-111 | None |
| A0A6G8CHU1 | 32-114 | None |
| A0A5R8WIU9 | 3-89 | None |
| A0A5R8WIU1 | 2-95 | None |
| A0A5R8WIN9 | 33-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.