DPCstruct | MC14025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 196 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838SXB5 | 1-203 | MSRTLVERSAEFLQARTSRRSFLAKAAIVGSALAAAPATYLLRPGSAYGAVCGPDSSCSDGYTVFCCSINRGMNKCPPGTFVGGWWK… |
| A0A7K0K042 | 1-203 | MSLTDRLAGALERRVSRRSFLVRSTFAGSALAAGRARWLVEPRSAYHELCNSVYCGSSACSCSSTCCAGYTEFCCTLDGGYNSCPPG… |
| A0A6J4I6W1 | 4-199 | None |
| A0A538H5N7 | 12-184 | None |
| A0A6I5XAK3 | 18-207 | None |
| A0A7Y3DGV3 | 188-387 | None |
| A0A6B1E5I3 | 1-204 | None |
| A0A538FDT3 | 1-203 | None |
| A0A7W0P0T8 | 1-199 | None |
| A0A286EJB1 | 14-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.