DPCstruct | MC14022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 18.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.17 |
| Pfam Score | 84.64 |
| Assigned Pfam label(s) | PF02625- CL0382- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0JWU2 | 4-117 | DLSGRSLELRAGRVPFVHARVTLAEAPTSAKPGDEAIIRADGAIEGFVGGVCAESTVREVATDLLASGAGPIVLRVTPEPEPDQPGR… |
| A0A536KL24 | 3-114 | EVEIELARRLEAGEEVVLATVVRTDGAPPSAPGAKALLARESALAGTLGCSEFDSAAQADAAGLLDAGEPALRTYRHDLGSIEVYLE… |
| A0A535EJD9 | 3-111 | None |
| A0A0P7YCI7 | 6-113 | None |
| A0A4D4N402 | 3-117 | None |
| A0A6L4Z5E0 | 2-138 | None |
| A0A1Y2NLU0 | 3-118 | None |
| A0A7C1A0B5 | 4-106 | None |
| A0A244C3B4 | 21-130 | None |
| A0A2N1S1I2 | 4-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.