DPCstruct | MC14021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0YTX8 | 10-97 | LEGLKKVSPGTILREGIENIVQAKMGSIIVLSDLKKVRKIFNGGFRIDCKLTPSKLYELSKMDGALILNEDGTRIIYANTHLFPNPRI |
| A0A7K0JVM4 | 1-89 | MLAALRAVAPGRPLREGLDRILQANKGAIIVVGDGPDVLAICSGGFLLDAEFSPQRVSELTKMDGAIILAGDASRIARANVHLVPNP… |
| A0A7X9H4L5 | 1-94 | None |
| A0A1W9TIA6 | 8-96 | None |
| A0A1X0KD52 | 9-94 | None |
| A0A0N0ATS7 | 14-96 | None |
| A0A2V9ZTY0 | 102-182 | None |
| A0A358ZXC5 | 54-131 | None |
| A0A3P8LIQ1 | 53-127 | None |
| F9PI16 | 10-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.