DPCstruct | MC14020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 249 ± 37 aa |
| Standard deviation of domain lengths | 36.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0522 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2WLN8 | 26-298 | TWSSALSTSAFAAIRSVGFEPVGQAMGSTVYQLGRSSRNWGYYDCLYLGAGYTMSTAPGQVALSGDGAPAAGLVHVFDEARRTALGR… |
| A0A7K0JTC1 | 38-298 | ADLALEVLRGDHETTDAVVTSLSVDEAILLDQVGYEPVGLLTGASVVQVAAFAGLGVGFSANGELGQLSEALEVARVRALGRLTDEA… |
| A0A7J8FVK6 | 270-591 | None |
| A0A3P7MII1 | 22-361 | None |
| A0A2W6BTL1 | 79-346 | None |
| A0A1I8IMS7 | 2-227 | None |
| G0TKP2 | 2-212 | None |
| F1KT95 | 273-504 | None |
| A0A812VL09 | 2-216 | None |
| A0A1Y3ELC4 | 1-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.