DPCstruct | MC1402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 117 ± 8 aa |
| Standard deviation of domain lengths | 8.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495IBN5 | 8-120 | ELPFDLDLTGEERALLRRGLNEWGGPARPTDALAVMLGFADKNDLWRSGEYLRKLLQAQESMTATDWHRILFAVEVVFVSDRWGSGW… |
| A0A7I7K9B4 | 63-189 | AVDLTEREREFIQQALEQWALSAADAPFPFQILGLSTWDEFGDLTVRLKRAVTNGASLTDLDWARALFLTEITWASDLIGAGLDFAT… |
| A0A1X1XBL6 | 3-132 | None |
| A0A3E0VP13 | 1-118 | None |
| A0A1X1UDP9 | 3-95 | None |
| A0A238XKK9 | 2-115 | None |
| A0A1Q4ZLY7 | 1-120 | None |
| A0A0H5S8H3 | 226-344 | None |
| A0A2T0VE06 | 103-219 | None |
| A0A1A6BJT4 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.