DPCstruct | MC14019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R2Q165 | 24-148 | PTIVVVPWVDPVVDEAGASVFSRYVEMYWLPVLGPSALWMMRRMVMGFETLPAGYEMDCATTATDLGLSFSASPNCSFSRSLSRCLH… |
| A0A7K0JQ24 | 2-123 | PWPDPGLERVGHRPGSPYVEACWVSVIGPSAAWAWQRLARQAVSHPGSSVEVAELSASLGLGAPHGRNATIYRTLARLASFGAATPG… |
| A0A524B2T8 | 87-212 | None |
| A0A7W1CNX0 | 2-124 | None |
| A0A3B0SFF0 | 1-100 | None |
| A0A7X9KGC6 | 6-122 | None |
| A0A7C1UJC1 | 36-165 | None |
| A0A6N7FQE7 | 23-162 | None |
| A0A5C7Y1Q0 | 7-140 | None |
| A0A5C7XXY2 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.