DPCstruct | MC14017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF08707- PF19808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5BC67 | 25-131 | SPVVNTGDSADDVEIVIQRLEAGHIDITSGYDNWRDIGFAFADEFRENGRDYFHRVSRFHPDYDERNTDEQYDKCLRAHRTGVTLNT… |
| A0A1I6REB0 | 4-108 | YRQLLTINIMRNLIRLSKPTEAFFRKSIKDIDKNSRDITKNYKYKNQLGLAFANTYGEQARDFFHIICKPNANYDKLKCNVEYTEYL… |
| K9ES57 | 3-96 | None |
| A0A412X1P6 | 290-388 | None |
| A0A7J0AW85 | 2-105 | None |
| A0A2D8CJR4 | 131-234 | None |
| A0A379MTH6 | 211-341 | None |
| A0A379MNL4 | 220-323 | None |
| A0A2V3PSR4 | 112-219 | None |
| A0A1H4DDK9 | 5-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.