DPCstruct | MC14015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 141 ± 25 aa |
| Standard deviation of domain lengths | 24.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8AP35 | 16-135 | NRRIALQEQVSSGVLRYFSDQEYDILTTDQLTSRYLRIGQKPPAGTLSDKIEHLKRTERTRKIKLWHDHSSILNHSYVCFTISWLYD… |
| A0A6S7K036 | 1-178 | MKKEKRDCYRKVKTQIEEEWKETDILRCFGNRQSLKSHQKDRLAQAFEPRLSPEHSQYEKLTLNDDGMIVQSEFVVEGQKQPLTVIR… |
| A0A7M5X6F1 | 170-327 | None |
| A0A6S7GXW1 | 2-142 | None |
| A0A7M5VD16 | 1-125 | None |
| A0A6S7HB41 | 2-129 | None |
| A0A2B4RI14 | 133-295 | None |
| A0A8B6EYX0 | 481-628 | None |
| A0A7J7J549 | 14-151 | None |
| A0A7D9DFW1 | 99-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.