DPCstruct | MC14014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 68 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A667ZAU2 | 45-108 | RCCPGYWGQDCIECPEHASMPCNNNGVCSDGMGGNGTCSCKDGYTGTACEDCAPNRYGSTCGSV |
| A0A4W5RRT7 | 128-191 | RCCGGFYGEHCEPCPGPKGQPCYGNGMCQDRTNGTGVCQCNKGFNGTACETCQEGKYGIHCDQD |
| H3C877 | 493-554 | None |
| A0A7J8JPE8 | 58-125 | None |
| A0A4Z2H4R2 | 276-333 | None |
| A0A7J7Z9B5 | 552-609 | None |
| A0A7Y4VQU5 | 279-338 | None |
| A0A1A9W6Q8 | 170-248 | None |
| A0A6P6D210 | 100-163 | None |
| A0A182SJT5 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.